Dig.do provides summary information about websites
Discover the most popular sites
Search domain or keyword:



Site preview (buddypress.org):
buddypress.org site thumbnail

Backlink tool

Domains linking from their homepages to buddypress.org:

List of 864 incoming links to buddypress.org:

  1. wordpress.org
    WordPress : Blog Tool, Publishing Platform, and CMS (access rank: 111)
  2. automattic.com
    Automattic (access rank: 14214)
  3. bbpress.org
    bbPress.org (access rank: 14596)
  4. wordpress.net
    WordPress : Blog Tool, Publishing Platform, and CMS (access rank: 40871)
  5. saopaulofc.com.br
    SPNet - O Termômetro da Torcida Tricolor - SPFC (access rank: 42018)
  6. berlios.de
    BerliOS (access rank: 47871)
  7. youlookfab.com
    Style Advice for Fashion Lovers | YouLookFab (access rank: 70306)
  8. urch.com
    Urch (Beta) (access rank: 77964)
  9. testbp.org
    BuddyPress Test Drive (access rank: 91842)
  10. noblogs.org
    Noblogs (access rank: 95704)
  11. travelreflex.com
    Travel Network, Holiday Reviews,Tips Ideas - TravelReflex (access rank: 124571)
  12. theme-dutch.com
    THEMEDUTCH  Dutch Flavoured Wordpress Theme Development Theme dutch - Dutch Flavoured Premium Wordpress Themes (access rank: 151897)
  13. companyprofile.biz
    Business Networking (access rank: 159241)
  14. menviews.com
    Men Views | Home (access rank: 182290)
  15. uidnumber.org
    AADHAAR  uidnumber.org (access rank: 186119)
  16. scriptureonfire.com
    | (access rank: 199298)
  17. easternschool.org
    Eastern School (access rank: 211473)
  18. 4reviewz.net
    India Technology News | Latest Product | Reviews | Products ComparisonIndia's Technology News | Latest Product | Reviews | Products Comparison (access rank: 260141)
  19. brukt-nytt.com
    brukt-nytt.com | Home (access rank: 260402)
  20. oafallarme.com
    Opposites Attract (access rank: 260946)
  21. frasesimagenes.com
    Imágenes Con Frases (access rank: 280423)
  22. noticierodelcine.com
    Muviñus (access rank: 296872)
  23. mindsports.info
    Mind sports (access rank: 302940)
  24. latestsightings.com
    Kruger Park: Find the latest wildlife sightings at Kruger National Park (access rank: 319428)
  25. williamsdavid.net
    Wordless Wednesday by David (access rank: 320165)
  26. plugintable.com
    The Periodic Table of WordPress Plugins (access rank: 320473)
  27. hitchwiki.org
    Hitchwiki - The Hitchhiker's Guide to Hitchhiking the World (access rank: 324435)
  28. sheinformed.com
    She Informed (access rank: 334407)
  29. blogsport.eu
    blogsport.eu | Home (access rank: 352312)
  30. recruitingcommand.com
    Recruiting Command | Home (access rank: 362382)
  31. macromediax.com
    آموزش طراحی وب سایت (access rank: 383128)
  32. peoplewhocarefund.org
    People Who Care Fund (access rank: 403752)
  33. resumetemplatesformac.com
    Resume Templates for Mac - Your complete Resume Resource Center including Cover Letters, Targeted Job Search Strategy Guides and professional templates (access rank: 409877)
  34. justaddsocial.com
    Just Add Social | Home (access rank: 415782)
  35. inlabeauty.com
    inlabeauty.com, a Beautiful Place to Find Beauty (access rank: 418252)
  36. austinadvertisingalliance.com
    Austin Advertising Alliance (access rank: 430907)
  37. smartideabox.com
    Smartideabox (access rank: 449189)
  38. referendum12.org
    referendum12.org (access rank: 449660)
  39. 4an.eu
    4an (Get Your Free Wordpress Blog) (access rank: 464135)
  40. sandboxdev.com
    Chicago WordPress PHP Development | Sandbox Development and Consulting Inc. (access rank: 470491)
  41. bp-fr.net
    BuddyPress France (access rank: 474939)
  42. cidadaos.org.br
    Cidadãos | Home (access rank: 494963)
  43. lifeinnorway.net
    Life in Norway - An expats travel, culture and language blog for Norway lovers (access rank: 501700)
  44. beautifuldayinparadise.com
    Beautiful Day in Paradise (access rank: 508825)
  45. edmjournal.com
    Journal of EDM Finance - Emerging Domestic Markets Finance (access rank: 517254)
  46. gofishing.se
    Gofishing -Powered by Redburn | Hem (access rank: 517792)
  47. highschoolparentsspeakout.com
    HIGH SCHOOL SPEAKOUT (access rank: 554448)
  48. newaydeals.com
    Review My Android | android lifestyleReview My Android (access rank: 557778)
  49. abaermis.com
    official translations|legal translations|website translations|medical translations (access rank: 561199)
  50. clubedosms.com
    Clube do SMS (access rank: 564187)
  51. soopbook.es
    SoopBook | Escribe tu libro. Soluciones modernas para el antiguo arte de escribir (access rank: 578331)
  52. portalsementinhakids.com
    Sementinha Kids (access rank: 600348)
  53. onlinepowerdotcom.com
    Online Tools DotCom (access rank: 608891)
  54. culturevisuelle.org
    Culture Visuelle | Média social d'enseignement et de recherche (access rank: 616741)
  55. tadowe.com
    Politics Spoken Here (access rank: 633058)
  56. edubuzz.org
    Activity | eduBuzz.org Learning NetworkeduBuzz.org Learning Network (access rank: 638014)
  57. openwebcms.es
    OpenWebCMS - Gestores de contenido Opensource (access rank: 643200)
  58. lastlaughcreative.com
    Customized WordPress Web Design in the East Bay | Last Laugh Creative (access rank: 652305)
  59. wpnyc.org
    WordPress NYC Community (access rank: 663683)
  60. inforaise.net
    ダイエット | ホーム (access rank: 664644)
  61. alumnipolmed.org
    Alumni Politeknik Negeri Medan - Polmed USU (access rank: 671018)
  62. postcrosserhaven.com
    A Postcrosser Haven (access rank: 673311)
  63. religionwhispers.com
    Religion Whispers - Religion in 21st century (access rank: 682784)
  64. solarlove.org
    Solar News Commentary −Solar Love! (access rank: 682862)
  65. karolinapiskorz.com
    Welcome! | karolinapiskorz.com (access rank: 696480)
  66. jonathanwold.com
    Jonathan Wold - Entrepreneurialism, Web Development, Faith, and Film (access rank: 703571)
  67. lowermycostofliving.com
    Lower My Cost of Living (access rank: 708575)
  68. edventureproject.com
    Edventure Project (access rank: 709062)
  69. lovingsimpleliving.com
    Loving Simple Living | Using minimalism to declutter, destress and focus on what matters (access rank: 715345)
  70. donovancrow.com
    Donovan Crow - Information for the mind creating Web Technlogies (access rank: 718950)
  71. stuffatfingers.com
    STUFFATFINGERS (access rank: 731679)
  72. autogordelverlenger.nl
    Producten - Auto Gordelverlenger (access rank: 739449)
  73. seomachine.net
    SEO Machine | The Ultimate SEO website (access rank: 746950)
  74. radiofactsvoicebox.com
    DJbiz.co (access rank: 749782)
  75. bookblogger.org
    Proudly powered by WordPress and BuddyPress. (access rank: 752332)
  76. shabushabu.eu
    Yummy Webdesign Tasty Solutions | ShabuShabu Webdesign (access rank: 773258)
  77. foronex.be
    Fortinex (access rank: 781312)
  78. easyshopassistant.com
    Connecting Gamers | Home (access rank: 787381)
  79. london-league.co.uk
    london-league.co.uk | Home (access rank: 790303)
  80. ubkom.org
    Fikom Universitas Borobudur (access rank: 791876)
  81. musicandflicks.com
    Music and Flicks - Just another WordPress site (access rank: 805746)
  82. socialboozer.com
    Social Boozer - Sign Up, Have a Drink and Connect (access rank: 819807)
  83. imathi.eu
    imathi.eu (access rank: 833884)
  84. impaladigital.co.uk
    Digital Marketing | Birchwood | Warrington | Cheshire | ImpalaDigital (access rank: 847489)
  85. healkick.com
    healKick (access rank: 850359)
  86. intouchwithtech.com
    Home (access rank: 861409)
  87. soguild.eu
    Special Olympics – Rift Guild (access rank: 862080)
  88. symbiostock.com
    Welcome to Symbiostock - Site Under Construction - Symbiostock, the Integrated Microstock Community (access rank: 862936)
  89. fakeginger.com
    Fake Ginger (access rank: 868829)
  90. desempregados.net
    DESEMPREGADOS.net | Início (access rank: 871150)
  91. androidplace.blog.br
    Android Place – Blog (access rank: 895960)
  92. robot-afk.com
    Robot-AFK (access rank: 896745)
  93. recovery5k.com
    Cleveland Run for Recovery 5K (access rank: 917281)
  94. worldclassmedia.com
    Viral Marketing - B2B Social Media Company - Design SEO PPC SEM (access rank: 921568)
  95. allaboutgalaxynote.com
    Galaxy Note Owners Community (access rank: 922115)
  96. internationalsimulation.com
    International Simulation | Home (access rank: 929939)
  97. culturetown.org
    CultureTown (access rank: 944450)
  98. aquariusonline.net
    (access rank: 948467)
  99. it580.com
    IT580博客群 (access rank: 955976)
  100. abogados.ec
    Abogados.ec (access rank: 959193)
  101. createhullabaloo.com
    Hullabaloo (access rank: 969517)
  102. linkdinsight.com
    Make Free Blog | Business Blogs | Free Website | Blog Marketing (access rank: 971474)
  103. ekolobcn.com
    ekolobcn.com (access rank: 973523)
  104. shoplikspace.com
    Online Shopping (access rank: 977905)
  105. joelstrumpet.com
    Joel's Trumpet (access rank: 979053)
  106. ctea.med.br
    Blog da Comunidade Ctea | Início (access rank: 987457)
  107. innovativeteamwork.com
    Innovative Teamwork (access rank: 998954)
  108. 1000destinos.com
    1000 destinos (access rank: 999633)
  109. 3dorigamiart.com
    3D Origami Art
  110. 3uu.info
    3uu.info Blogs
  111. abizeitung-abibuch.de
    Abizeitung / Abibuch drucken - ab € 3,90…
  112. aceinspire.com
    ACE Inspire
  113. addictioncounsellingringwood.com
    addictioncounsellingringwood.com
  114. aefperj.com.br
    Associação de Futebol de Praia – RJ
  115. aerolineasmexicanas.mx
    Aerolíneas Mexicanas
  116. aloe4us.com
    Forever Living Products Independent Distributor
  117. alteregoo.com
    AlterEgo
  118. aluminumroofingsystem.com
    Aluminum Roofing System | Home
  119. androidfordummies.it
    Installazione Wordpress Test | Solo un altro sito WordPressInstallazione Wordpress Test
  120. angelramirezdelc.com
    Angel Ramirez - Mercadeo y Negocios
  121. animesocietyuk.com
    Anime Society UK
  122. apex-series.com
    Apex 2013
  123. appleyeah.com
    Apple Yeah !
  124. architect.tw
    台灣建築部落客
  125. areaguides.us
    Area Guides, Ask Questions, Get Answers
  126. aspeninvestmentforum.com
    Global Investment Expertise for Social Fundraising
  127. authoringbooks.com
    Authoring iBooks
  128. avonitalia.altervista.org
    Social Network non ufficiale Avon | Home
  129. bakersfieldbug.com
  130. battlecity.org
    Battle City
  131. betafoot.com
    Paddle | Betafoot
  132. bigfriendsgroup.co.uk
    Big Friends Group UK
  133. bluecrossvetclinicmalta.com
    Blue Cross Veterinary Clinic
  134. bootcampowners.com
    Boot Camp Owners Network
  135. bp-tutorials.de
    BuddyPress Tutorials - Themes, Plugins und Tutorials für BuddyPress
  136. buddypress-it.it
    BuddyPress Italy
  137. budgetprimeresources.com
    Budget Prime Resources
  138. bujanconsultingservices.com
    Bujan Consulting Services
  139. bz6.org
    Crear blog gratis
  140. carsdesktop.com
    Cars Desktop - Car and Driver Reviews
  141. cashealthcare.com
    CAS Healthcare - Treatment For Your Symptoms
  142. centreusers.org
    Centre/SIS Users
  143. chinohillspizzaria.com
    Chino Hills Pizza
  144. christiantoo.com
    ChristianToo
  145. cloudmum.com
    cloud mum
  146. clubstats.co.uk
    clubstats - ultimate football stats for anoraks | Home
  147. codex.wordpress.org
    Main Page WordPress Codex
  148. coffee-millionaire-network.com
    Coffee Millionaire network Force Matrix Recruiting System
  149. coffeeclubnetwork.com
    CoffeeClub
  150. colearningnetwork.org
    CoLearning Network
  151. communityinformalcontrol.com
    Communityinformalcontrol.com
  152. communityrummage.com
    Community Rummage, Sell, Buy, Trade and Give your rummage to others. Promote your Business's or your Yard sales Community Rummage allows you to do it
  153. compartiendoviajes.com
    Compartiendo Viajes
  154. connectwithworld.altervista.org
    Connect | Home
  155. conselho.org
    CNE
  156. consinergia.es
    Con Sinergia
  157. corbolma.altervista.org
    Mauro Corboli | Home
  158. courtcapitalpartners.co.uk
    Court Capital Partners
  159. covs67.com
    Social Networking Webmasters...
  160. craftypages.com
    Crafty Pages - The Ultimate Minecraft Fan Site
  161. creationsiteweb.net
    Private world
  162. crewcruisecritic.net
    Crew Cruise Critic . net | Home
  163. cristianmunoz.es
    Cristian Muñoz Muñoz - Programador Web, inquieto, autodidacta y sobretodo modesto :)
  164. crocheteur.com
    Crochet patterns and instructions, all about crocheting online.
  165. culturaforex.com
    Cultura Forex
  166. curelauncher.com
    Donate to Breast Cancer Treatment and Research Funding | cureLauncher
  167. cyclist411.com
    Cyclist 411 - Cyclist 411 community inspired cycling intelligence
  168. datenight.com.au
    date night | Home
  169. die-partei-aalen.de
    Die PARTEI  Aalen
  170. die-webboxer.de
    Die Webboxer - SEO Online Positionierer Berlin
  171. donatehow.com
    Non-Profit Donation Strategies
  172. drivemecrazyfamilyadventure.com
    Drive Me Crazy Family Adventure -
  173. drivethenation.com
    Drive The Nation
  174. e-habits.com
    E-habits - Have you got the habit?
  175. elcabilo.com
    El Cabiló 2.0
  176. electronicmusiccafe.com
    Electronic Music Cafe Social Network
  177. empowermentlivinginstitute.com
    Empowerment Living Institute
  178. engenhariadeproduto.com
    Engenharia de Produto
  179. enggisko.net
    Engg Isko | Home
  180. erasingaporesalespersons.com
    ERA PROPERTY AGENT RECRUITMENT CAREER
  181. eupon.it
    EUPON
  182. euteambuild.com
  183. ewebscapes.com
    E.Webscapes Blog Design Studio - Premium WordPress Themes Made to Order
  184. fanstars.at
    Marketing mit WordPress | die 1. deutsche Community für WP-Marketing
  185. fidodo.biz
    Fidodo.biz
  186. finalwebmarketing.com
    Final Web Marketing
  187. fishvillecommunity.com
    Fish Ville Community
  188. fotoanuncialo.com
    Proudly powered by WordPress and BuddyPress.
  189. fredrickbruhn.com
    FredrickBruhn.com
  190. friendvenue.com
    Friend Venue
  191. gameoncon.com
    gameoncon.com | Home
  192. gamingoutpost.com
    The Gaming Outpost
  193. geekdicas.com.br
    Geek Dicas
  194. gesdecom.com
    Gestión Desarrollo Comercial
  195. getlocalwebtraffic.info
    How To Increase Website Traffic | Local SEO| Local Internet Traffic
  196. glamourtogo.be
  197. glocal24.com
    Glocal24.com, The first ever citizen journalism news site in Bangladesh | ISSN: 2224-0594
  198. gobof.org
    SouJava | Home
  199. golfnerdz.net
    GolfNerdz
  200. granittoghagemiljo.no
    Granitt og Hage Miljø
  201. grocerystorefriend.com
    Grocery Store Friend
  202. hairtaim.ch
    freie termine beim coiffure
  203. healthandautoinsurance.com
    Health And Auto Insurance
  204. healthforumforall.org
    healthforumforall
  205. heeldenbosch.nl
    Heel Den Bosch | Samenwerking duurzaamheid en echtheid in en om 's-Hertogenbosch
  206. heycheri.com
    HEYCHERI
  207. high-ti.fr
    High TI
  208. hiphop10.com
    Hip Hop 10
  209. hockeytimeamerica.com
    USA Hockey - Your Ultimate Source
  210. holaquetal.eu
    Hola ¿que tal? - Red Social - Otro sitio realizado por Globatium S.L.
  211. holisti.ca
    holisti.ca | Home
  212. homefoodvendor.com
    HomefoodVendor
  213. homesecuritysystemreviewsz.com
    Home security system reviews
  214. hotmobilenews.com
    Hot Mobile Phone News and Reviews
  215. hullworks.com
    Hull Works
  216. hum-gum.com
    HumGum | Magazine, blogs créative shops !
  217. iblog365.com
    iBlog365.com: info hub
  218. ieatmypigeon.com
    I Eat My Pigeon
  219. ihavearthritistoo.com
    I Have Arthritis Too
  220. ileane.wordpress.com
    ms. ileane speaks | Insights on social media, life, love, music, money and anything else that comes to mind.
  221. ilocals.info
  222. incubator2.cz
    Incubator2
  223. indiesquish.com
    IndieSquish - Multiplayer Indie Games
  224. indivouchers.com
    Indivouchers
  225. infopromosi.com
    InfoPromosi-Information Promotion
  226. instantfrontline.com
    Instant FrontLine
  227. insuranceapprentice.com
    Insurance Marketing and Insurance SEO  The Insurance Apprentice  Insurance Social Media and Insurance Search Engine Marketing
  228. intrapixel.net
    Intrapixel
  229. inversionabierta.com
    Inversión Abierta
  230. ironicandsad.com
    Ironic and Sad | Home
  231. islingtonwharf.com
    Islington Wharf
  232. jjhit.com
    Game hardware and Online game guide
  233. jontechkid.com
    Jon The Tech Kid -
  234. journalismaccelerator.com
    Journalism Accelerator: A forum about innovation in journalism, beyond the usual suspects
  235. la-photographie.com
  236. laborwerte-app.de
    Die Laborwerte App - Meine Blutwerte mobil dokumentieren - Blutwerte App
  237. ladiescarinsurancewomencheapdiscount.com
    Ladies Car Insurance
  238. learn-coding.com
    Learn coding
  239. learnanythingnow.com
    LearnAnythingNow.com | Home
  240. limousinesservices.ca
    Limousines Services
  241. limug.org
    LIMUG : LinkedIn Mac Users Group | LinkedIn Mac Users Group
  242. linkedout.co
    LinkedOut - Building Relationships Outdoors
  243. liveaquaria.co.za
    Live Aquaria | Aquarium Social Network
  244. livethelyrics.tk
    Live the Lyrics
  245. lizharmon.com
    LizHarmon.com
  246. londonolympicnews.com
    Olympics Social Network
  247. maceratesinelmondo.it
    Maceratesi nel Mondo | Home
  248. mainelearning.net
    Maine Learning Network
  249. marketchacha.com
    CheapHost Domain ragistration at MarketChacha.com
  250. medialabswest.se
    Medieverkstäderna
  251. medivasc.com
    MEDIVASC LTD
  252. meetuniversitygirls.com
    Meet University Girls
  253. meinblog.de
    Meinblog.de - kostenloses bloggen mit eigenem Blog bzw. Tagebuch
  254. metalwebonlineradio.com
    Metal Music Community - MetalWeb
  255. miltonkeynesgolf.co.uk
    MK Golf | The Golfers Network... Milton KeynesMK Golf
  256. mipuntolatino.com
    Mi Punto Latino
  257. mlmdownlinebuildersalliance.com
    MLM Downline Builders Alliance
  258. modifiedmotorcycles.com
    Modified Motorcycles - Finding Your Inner Desires
  259. myeasttexasweather.com
    MyEastTexasWeather.com
  260. myeducationnation.com
    myeducationnation.com
  261. myfirstblog.net
    MyFirstBlog.net: More than blogs, it is a network
  262. myrealestate.sg
    My Real Estate Singapore
  263. myteensocial.com
    Teen Social
  264. mytravelfortwo.com
    My Travel for Two | Home
  265. naturalyou.co.za
    Natural You - Creating Balance
  266. noodlefishingjugs.com
    Fishing Noodles
  267. normanos.com
    normanos.com
  268. nortonfanclub.com
  269. nxsn.com
    Huseyin Berberoglu | I develop Wordpress things for you.
  270. nycga.net
    NYC General Assembly # Occupy Wall Street
  271. occupyphilly.org
    OccupyPhilly.Org
  272. occupywinstonsalem.org
    Occupy Winston-Salem
  273. offerton.net
    Offerton.net | Home
  274. oldschoolsurfshop.com
    Old School Surf Shop - Finding The Right Waves
  275. packagingby2020.com
    packagingby2020.com
  276. pagesforeveryone.com
    Free web Pages For Everyone, do you want to create a free blog for your business?
  277. parlacatala.org
    Parlacatala.org
  278. pasaodeflow.com
    La original las demas son copias baratas. | Home
  279. pdp.fi
    Product Development Project
  280. pennyspike.com
    Penny Stock Traders Choice, PennySpike
  281. peoplepoweredprogress.com
    people powered progress | Home
  282. pethealthandtraining.com
    Pet Health and Training - For Pet Lovers
  283. planet.wordpress.org
    WordPress
  284. politicalgrinder.com
    The Political Grinder | Home
  285. politicalprayerchain.com
    Political Prayer Chain
  286. prep-net.com
    Prep-Net.Com
  287. pressworker.com
    PressWorker.com
  288. proyectom.org
    Juan Mejorada
  289. pseric.com
    Pseric's World
  290. ratmate.com
    Ratmate.com
  291. realtorsfrombrazil.com
    Realtors from Brazil
  292. recipeblog.co
    Recipe Blog Co-Op - A food and recipe blog community
  293. reclaimourcountry.com
    Reclaim Our Country | Home
  294. redconsultor.com
    Red Consultor Internacional
  295. religiousdebates.co.uk
    Religious Debates
  296. repairpalz.com
    Repair Palz Social Network | Home
  297. rio20.net
    Portal Río+20 | Construyendo la Cumbre de los Pueblos Río+20
  298. rotaryeclub5610.org
    Rotary eClub 5610
  299. rrcommunity.com
    Randall-Reilly Community CMS | Home
  300. runnerseden.com
    Adventures In Running
  301. rvshoppingcenter.com
    RV Shopping Center - RV Reviews
  302. sarudeki.jp
    サルでき.jp | iPhoneアプリ作りを楽しむ人のポータルサイト
  303. saviourssocial.com
    SavioursSocial.com
  304. schesis.net
    Schesis
  305. scrapbookingneeds.com
    Scrapbooking Needs - How To Create A Scrapbook
  306. secondlettermedia.com
    2LMedia
  307. shadenaturals.com
    Shade Naturals
  308. sidux.com
    sidux e.V. - Gemeinsam für Freie Software
  309. singaporebestforexcoursesreviews.com
    Singapore Best Forex Courses Reviews
  310. sitcomp.org
    SitCom:p | Home
  311. skatedoggclothing.com
    Skate Dogg Clothing
  312. smilevolunteers.org
    Smile Volunteers
  313. snugasabugbaby.com
    Snug as a Bug Baby
  314. socialplace.fr
    SocialPlace
  315. socialsciencespace.com
    social science space | A space to explore, share and shape the issues facing social scientists
  316. soratobuinu.com
    honeymal
  317. sports46.com
    www.sports46.com
  318. startup.bo
    Startup.bo
  319. status.pk
    status
  320. stocktrading4u.com
    Stock Trading | Home
  321. summonerslist.com
    Summoner's List
  322. surveyor-forum.co.uk
    Surveyor Forum
  323. tahoecan.org
    Tahoe CAN | Home
  324. tasteofslow.com
    | http://tasteofslow.comhttp://tasteofslow.com
  325. teachparent.com
    TeachParent.com | Parents helping Parents
  326. technicaladvices.com
    Technical Advices
  327. thefinestinfantasy.com
    The Finest in Fantasy.com - World's Best Fantasy Sports Site
  328. theforexroom.com
    The Forex Room
  329. thehyipblog.net
    The HYIP Blog: Reviews, Monitoring, Investments, HYIPs
  330. thelennoxx.com
    theLENNOXX
  331. themicrobusinessnetwork.co.uk
    The Micro Business Network
  332. thenewchalk.com
    The New Chalk
  333. thenewreformation.com
    The NEW Reformation
  334. theoutlawmom.com
    The Outlaw Mom (TM) Blog
  335. thychu.com
    Activity Streams
  336. tibetansatuniversity.com
    Tibetans At University
  337. tlhmoms.com
    TLH Moms
  338. tolearnalanguage.com
    To Learn A Language
  339. topturlockagents.com
    Reed Realty
  340. travelvital.de
    WWW.TRAVELVITAL.DE | Schön Gesund - Gesundheitstourismus in der TürkeiWWW.TRAVELVITAL.DE
  341. trendury.com
    Trendury | Home
  342. triopsguys.com
    Triops Guys - Your go-to guide on triops
  343. trishmo0r3.webnode.com
    Monsoon Climates
  344. trishmo0r3.webs.com
    trishmo0r3
  345. trishmo0r3.weebly.com
    trishmo0r3 - Home
  346. umalumni.my
    Persatuan Alumni UM
  347. uptotheminutebasketball.com
    Up To The Minute Basketball Updates
  348. vdoop.com
    Vdoop.com
  349. viking-craft.net
    Viking-Craft
  350. viralmarketingnews.com
    Viral Marketing Tips - B2B Social Media Strategists - NEWS
  351. vistamenus.com
    Css Menu Bar Template
  352. wahmsonline.com
    Wahms Online Business Network
  353. wajobline.com
    Welcome | WaJobLine.comWaJobLine.com
  354. warzoneminers.com
    Minecraft Faction Server
  355. wasgestalten.de
    InDesign Vorlagen und mehr
  356. watchmyweightloss.com
    Watch My Weight Loss - Exercise and Healthy Eating
  357. wdmac.com
    WDMAC - Web design & Development resources
  358. wearelyrics.com
    We Are Lyrics | Home
  359. weddingdaze.com
    WeddingDAZE | Home
  360. weloveindia.co.uk
    We Love India | Home
  361. wilsontrevon27.weebly.com
    wilsontrevon27 - Home
  362. womeninrotary.org
    Women In Rotary
  363. worddissection.com
    WordDissection.com - Word Dissection Vocabulary Building One Word at a Time
  364. wordpress.org.in
    WordPress › Blog Tool, Publishing Platform, and CMS
  365. wordpressense.com
    WordPress & AdSense - Working Together For Your Success
  366. wp-plugins.net
    WordPress › WordPress Plugins
  367. writeartperform.com
    Write Art Perform
  368. yachtcharterlife.com
    Carribean Charters, Yachts Sailboats and More!  St. Thomas VI Charters
  369. yweak.com
    yweak.com
  370. zeewebcamscheveningen.nl
    Zee webcam Scheveningen
  371. zlollisrealestate.com
    Aging in Place With Zlollis Real Estate
  372. buddydev.com
    Buddypress plugins, Buddypress free and premium themes, custom development and more (access rank: 85779)
  373. northcoastnow.com
    NorthCoastNow.com | Home (access rank: 103258)
  374. shortstorytelling.net
    초단문 스토리텔링 (access rank: 115068)
  375. inaregee.com
    Activity | Inaregee IM CampusInaregee IM Campus (access rank: 118726)
  376. bloground.ru
    Nothing found for (access rank: 134407)
  377. hangeulsound.net
    한글 사운드 (access rank: 138669)
  378. goldmoney1.ru
    Золотая жила (access rank: 139128)
  379. zaykar.com
    Global Networking Forum (access rank: 167281)
  380. webenso.com
    WordPress SEO and Web Marketing Technology Tips (access rank: 183513)
  381. saabsunited.com
    SaabsUnited.com (access rank: 205636)
  382. encrisis.com
    Comunidad ENCRISIS.COM (access rank: 208729)
  383. youthesteem.com
    Youth Esteem (access rank: 235474)
  384. ruya-ym.com
    مركز رؤيا الإعلامي | Ruya Center (access rank: 269410)
  385. blogosys.com
    WordPress and Blogger News " Blogosys (access rank: 279337)
  386. bmwklubtorun.pl
    BMW Klub Toruń (access rank: 283602)
  387. myvfs.com
    MyVFS (access rank: 306877)
  388. creepypastas.com
    Creepypasta en español | Los mejores creepypastas de Internet (access rank: 313511)
  389. neverwinterguides.com
    Neverwinter Guides (access rank: 343554)
  390. popo.lt
    PoPo.lt - patys sau žiniasklaida. Blogosferos žvaigždės. (access rank: 344292)
  391. renrengang.com
    แกงค์ครองโลก (access rank: 344524)
  392. shahidin.com
    Dad's Diary (access rank: 384566)
  393. onoxy.com
    onoxy.com (access rank: 385953)
  394. horosophy.com
    Activity | Wisdom Networking Forum (access rank: 419239)
  395. insidethefame.net
    Inside The Fame (access rank: 440506)
  396. xn--spkjgare-3za1p.com
    Hem | spökjägarna.com (access rank: 475166)
  397. thevillagemagazine.net
    The Village Magazine (access rank: 485018)
  398. semesterresa.eu
    Hem | Semesterresa i EU (access rank: 501021)
  399. livingwaychristianfriendshipgroup.com
    Livingway Christian Friendship Group (access rank: 503634)
  400. connorstuff.com
    Broke Blogger (access rank: 508350)
  401. nodolab.com
    contenido - nodolab (access rank: 510779)
  402. knowvigrxplusbetter.com
    VigRX Plus In-depth Study, Facts, and In-person Decision Making on It. (access rank: 517568)
  403. allsitelist.com
    All Submission Sites List (access rank: 518808)
  404. blood-sport.eu
    Réseau social arts martiaux et sports de combat. Social network martial arts and combat sports (access rank: 522136)
  405. worldseller.co.kr
    Home | 구글 마케터의 철학, 세계 (access rank: 525207)
  406. bestfreefiction.org
    Best Free Fiction (access rank: 528205)
  407. damefobal.com.ar
    Dame Fobal (access rank: 529119)
  408. gigape.com
    Gigape | Blog (access rank: 537914)
  409. auswanderersuchtfrau.com
    Auswanderer sucht Frau oder Mann (access rank: 542121)
  410. vanmorgan.tv
    Vanmorgan.tv (access rank: 553166)
  411. ristrutturazioni-case.com
    Ristrutturazione casa crea il tuo Blog gratis (access rank: 553436)
  412. glitztvla.com
    Glitz* (access rank: 561047)
  413. learnjazzstandards.com
    Learn Jazz Standards (access rank: 561640)
  414. groppie.com
    Groppie (access rank: 565238)
  415. mektuparkadasim.com
    Mektup Arkadaşım | Home (access rank: 567694)
  416. my-neighbors.net
    My Neighbors (access rank: 573848)
  417. friendoc.com.cn
    好友记 FrienDoc (access rank: 580744)
  418. dating4free.eu
    Dating 4 free - Gratis dejting! | dating4free (access rank: 581463)
  419. kikiandtea.com
    KiKi Tea (access rank: 592978)
  420. shushcrush.com
    ShushCrush (access rank: 610348)
  421. torontotravelmassive.com
    (access rank: 614994)
  422. chataboutchina.com
    The NEC (access rank: 617973)
  423. columbusbbw.com
    ColumbusBBW | Home (access rank: 623917)
  424. peddlerspond.com
    My Membership Options Page - Peddlerspond.com (access rank: 625227)
  425. theallergyblues.com
    Menu | The Allergy Blues (access rank: 631869)
  426. inlandcarpool.com
    INLAND CARPOOL (access rank: 636852)
  427. eagleclub.org
    (access rank: 642389)
  428. xn--8uqw7ohrptgueiee92b.tw
    涵采電腦│桃園電腦維修推薦店家,桃園電腦維修第一選擇 (access rank: 648736)
  429. windsurfing.pro
    Windsurfing .pro (access rank: 651374)
  430. sentinelit.com.au
    Sentinel IT (access rank: 661356)
  431. ponniyinselvan.in
    Ponniyin Selvan Varalaatru Peravai (access rank: 668599)
  432. voresbornholm.com
    Vores Bornholm – Snestorm hele året (access rank: 669163)
  433. boroconnect.com
    | Home (access rank: 670036)
  434. currentphotocontest.com
    CURRENT PHOTO CONTEST (access rank: 679262)
  435. humdani.com
    humdani.com (access rank: 679413)
  436. westmichiganworship.com
    West Michigan Worship (access rank: 682642)
  437. books4lunch.com
    Books 4 Lunch (access rank: 689774)
  438. disasterreliefgroup.org
    DRG (access rank: 700327)
  439. bpdevel.wordpress.com
    BuddyPress Development Updates (access rank: 708040)
  440. surfcash.co
    Get Paid for Surfing The Web | SurfCash | Home (access rank: 716856)
  441. wedevelopafrica.org
    Magic-Chat (access rank: 736016)
  442. tipscontrol.com
    TipsControl.com (access rank: 739476)
  443. prettythin.com
    PrettyThin (access rank: 740423)
  444. yarinavalverde.com
    The crossover (access rank: 743663)
  445. ketel-service.nl
    CV Ketel winkel (access rank: 743902)
  446. fastandfurioussix.com
    Fast And Furious Six (access rank: 751738)
  447. pickledplum.com
    Pickled Plum – A food site with simple Asian inspired, healthy and anti-aging recipes anyone can make. (access rank: 756462)
  448. actorstuff.com
    Actor Stuff (access rank: 763622)
  449. sho4l.com
    شغل.كوم (access rank: 767368)
  450. a8c.com
    Automattic (access rank: 771328)
  451. hikamedia.com
    *PRINTING ONLINE INDONESIA, PRODUSEN SKIN LAPTOP, MOUSEPAD, ID CARD, KARTU NAMA, MESIN CETAK PRINTING, MESIN CUTTING, ALAT POTONG, DLL* (access rank: 773748)
  452. reisefotos.co
    Reisefotos (access rank: 785613)
  453. unisonicascension.com
    Unisonic Ascension - Beyond Meditation (access rank: 789423)
  454. biz-for.biz
    Biz For Biz (access rank: 790055)
  455. czech-games.net
    (access rank: 809435)
  456. ebookgoogle.net
    FREE EBOOK SOCIAL NETWORK (access rank: 823526)
  457. swedbangla.com
    Portal for Bangladeshi Community in Sweden (access rank: 825991)
  458. whitepeopleschool.org
    | Home (access rank: 840192)
  459. wellness-info.org
    Naturheilkunde,mit derenHilfe lassen sich viele Erkrankungen behandeln (access rank: 844558)
  460. blogjom.com
    WordPress › Blog Tool, Publishing Platform, and CMS (access rank: 855346)
  461. cantfindfriends.com
    CantFindFriends (access rank: 856297)
  462. artykuly4you.pl
    ARTYKUŁY 4 YOU (access rank: 859015)
  463. antblogz.com
    AntBlogz.Com (access rank: 865132)
  464. ahappypocket.kr
    Happy Pocket Full of Money (access rank: 881437)
  465. lifeartpeace.net
    Life, Art Peace | Home (access rank: 885713)
  466. consideringgrace.com
    Considering Grace (access rank: 902575)
  467. keretaperodua.com
    Kereta Perodua | Viva, Myvi, Alza | Promosi & Diskaun | Senarai Harga (access rank: 902873)
  468. wu.gd
    สร้างบล็อกฟรี (access rank: 905582)
  469. sinolicious.com
    Sinolicious - China's expat community. (access rank: 912249)
  470. bostonbusinessprofessionals.com
    bostonbusinessprofessionals.com | Home (access rank: 915575)
  471. maxgigs.com
    Maxgigs (access rank: 920934)
  472. offgaming.us
    Fight with Tools (access rank: 936499)
  473. mysoloads.com
    My Solo Ads (access rank: 938499)
  474. sitngo.ru
    sitngo.ru (access rank: 942281)
  475. hookto.com
    World of Blogging (access rank: 944490)
  476. unifyyoseikan.org
    Unify Yoseikan (access rank: 947677)
  477. varsd.com
    VAR PLANET (access rank: 953076)
  478. forrestersofjamaica.com
    Forresters of Jamaica (access rank: 955334)
  479. incising.net
    Incising (access rank: 956561)
  480. igragame.com
    Игра - Game - игровой портал (access rank: 960781)
  481. gagabet.com
    (access rank: 964344)
  482. thisisnotabout.us
    (access rank: 971504)
  483. blsci.org
    Bernard L. Schwartz Communication Institute | Home (access rank: 971757)
  484. bisnis4u.com
    Bisnis4u.Com (access rank: 975865)
  485. geeks4peace.org
    Geeks4Peace.org (access rank: 992308)
  486. 123a1.com
    123A1.com – Interesting place
  487. 24-7social.net
    24-7 Social Network
  488. 24hoursforlivestrong.com
    Health and Healing
  489. 2bet.es
    2bet | Home
  490. 361tx.com
    Battle of the Bulge
  491. 3alices.com
    3Alices
  492. 3dworld.us
  493. 7minutesisallyouneed.com
    My 7 minute workout story | Home
  494. 888aka.com
    888AKA.COM | Home
  495. 911conspiracy.com
    911 conspiracy
  496. abicte.com
    Articles, photos, videos, news, discussion, social Network, people, health | abicte.com
  497. adoptionistas.com
    ADOPTIONISTAS
  498. aged30plus.com
    Aged30+
  499. alex11.org
    Alex11.org
  500. alialssaiari.com
    ALI ALSSAIARI
  501. alloyer.com
    Alloyer – 合金人
  502. alphacompany.org
    Thinking People - Great Minds Think Alike
  503. americaanswersback.com
    America Answers Back | America Answers Back .com
  504. angeltodemon.com
    angeltodemon.com
  505. animingler.com
    AniMingler
  506. apple-museum.ru
    Музей техники Apple
  507. appleliveblog.com
    Apple Live Blog
  508. arealfacts.com
    our blog
  509. artaddicbeta.com
    ArtAddicBeta
  510. arthurslegacy.com
    Halls of Avalon
  511. austria-blogs.com
    Austria Blogs
  512. autosmexico.mx
    Autos México
  513. avataricircle.com
    AvatariCircle
  514. awesomeindy.com
    NEA Guru Lunch | Home
  515. babyandme.nl
    Baby and me
  516. bankfiesta.com
    My Blog
  517. bayareahair.com
    My Website
  518. be-club.eu
    BE Club
  519. beachsidehealthonline.com
    Membership Only Content
  520. beatlesfansunite.com
    A Social Network for Beatles Fans | Join Free!
  521. beikaoce.com
    备考册
  522. berserki.ru
    Берсерки.Ру | Список: Activity
  523. bertharenteria.com
    Bertha Renteria
  524. best2best.it
    Best2Best: il social network utile
  525. bigbeautifulworld.nl
    Big Beautiful World
  526. bk-club.net
    Ближний Круг | Главная
  527. blockcamp.org
    BlockCamp
  528. blog43.com
    Blog43.com
  529. blogfu.eu
    Create free blogs with -
  530. bloggingwithkids.com
    Blogging with Kids: Learning Zone | Learning about Blogs while Blogging About KidsBlogging with Kids: Learning Zone
  531. blogs-uk.co.uk
    Blogs UK free blog and unlimited hosting for UK businesses and professionals
  532. blogvoyance.net
    Le blog de la voyance
  533. blogyan.com
    Free blog service
  534. boojoojoo.com
    boojoojoo.com
  535. bookemdanno.net
    Book 'em Danno - An Alex O'Loughlin & Scott Caan Fanpage
  536. boycottketk.com
    Boycott KETK
  537. brightfloridacity.com
    Bright Florida City
  538. brightmatches.com
    BrightMatches
  539. btteros.com
    Comunidad de BTTeros | Inicio
  540. buddylite.com
    BuddyLite.com | Home
  541. buecherbrett.org
    buecherbrett.org | Start
  542. built2scale.com
    built2scale
  543. burnfatlookfit.com
    Burn Fat Look Fit
  544. buttpen.altervista.org
    Buttpen | Home
  545. butuanblogs.com
    ButuanBlogs.com
  546. cadabra.co.za
    Cadabra!
  547. caeumsa.com
    Bienvenido
  548. carshowking.com
    Car show : The International Car Show King of Classic Antique, Lowrider & Import, Custom Auto & Truck Shows.
  549. catnipmagazine.com
    Catnip Magazine | Home
  550. cbfront.com
    WordPress › ClickBank Press WordPress Plugins
  551. cebupctech.com
    Cebu PCTech Association
  552. chaserzone.com
    ChaserZone
  553. chitownpros.com
    Chicago Professionals Networking Group
  554. closeyourhole.com
    Close Your Hole
  555. coloradospringssportsblog.com
    Colorado Springs Sports Blog
  556. comedyhill.com
    Comedy Hill
  557. compednet.com
    Welcome | CompEdNet
  558. conspiracyeight.com
    Fashion and Lifestyle Gossip with the occasional Fashion tip thrown in.
  559. conspiracyreel.com
    CONSPIRACY REEL
  560. cosmosvitamins.com
    |
  561. crackedmonocle.com
    Cracked Monocle
  562. creablogg.com
    Crea blog
  563. crixal.com
    criXal | Home
  564. crosstalknet.com
    Crosstalk Network
  565. datawiki.biz
    DataWiki Business Social Marketing
  566. dbryantmusic.com
    Dave Bryant Music | Home
  567. deadpeasantssociety.com
    Dead Peasants Society
  568. dedesparche.co
    deDesparche Blog
  569. desi.im
    Desi.Im
  570. diekeule.com
    die Keule Blog - Menschen, Leben, Lifestyle und mehr
  571. dietingtomorrow.com
    Dieting Tomorrow
  572. dietlabo.com
    Dietlabo
  573. domainetkinligi.com
    Domain Etkinliği
  574. doublebuffer.net
    DoubleBuffer
  575. dreamproject2015.com
    引き寄せの法則
  576. e1evation.org
    e1evation users
  577. eatcanteen.com
    湾区网 · 晋吉生活指南
  578. eatyoursidewalk.com
    - EAT YOUR SIDEWALK!
  579. ecopreneursclub.com
    Ecopreneurs Club
  580. educircles.org
    educircles.org
  581. edv-dienstleister.com
    46live | 46Live
  582. energiefabrik-koeln.de
    Energiefabrik Köln
  583. enlightus.net
    Enlightus | Home
  584. epetdate.com
    ePetDate.com | Home
  585. etourismbook.com
    eTourismBook
  586. facehackbook.altervista.org
    hackbook
  587. familiesfightforlife.org
    Families Fight For Life
  588. familyfisho.com
    Family Fisho | Fish for the family. Fish for the Fun. Fish for the Future!Family Fisho
  589. fastlinkin.com
    Fastlinkin
  590. fatboyclub.co.uk
    Fat Boy Club
  591. fatgirlspray.com
    HCG Diet | Fat Girl Spray.com
  592. femenic.com
    Inicio — Red Femenic
  593. findahoe.com
    WORLD WIDE PIMPIN NETWORK
  594. findyogabuddies.com
    Find Yoga Buddies
  595. fleaer.com
    Fleaer
  596. flipflopmama.com
    Flip Flop Mama
  597. fofocabook.com
    FoFocaBOOK
  598. forestrun.ro
    Forest Run
  599. fps360.com
    FPS360.COM
  600. franciscoluislinares.com
    Franciscoluislinares Blog
  601. freediettips.info
    Free Diet Tips and Diet Plans for Weight Loss and Healthy Life Style
  602. freezeout.altervista.org
    Freezeout | Home
  603. freindship.in
    FreindShip
  604. frmgr.com
    F R M G R
  605. ganodermacoffeeus.com
    Ganoderma coffe benefits, healthy and taste you will enjoy
  606. gentspub.com
    Gents Pub A Site For Men, By Men, To Be Men
  607. gibcosta.com
    GibCosta | Gibraltar News Chronicle | News media classified ads for Gib, the Costa del Sol and Andalucia | GibNews Panorama Focus Vox
  608. goingtohelp.net
    GoingToHelp.com | Home
  609. gremiolafortezza.tk
    Grêmio La Fortezza
  610. grifball.info
    American Grifball League of America
  611. groubicle.com
    Groubicle
  612. group1.in
    Group 1
  613. guysonguys.net
    Guys on Guys
  614. haulingfuel.com
    Hauling Fuel
  615. haveigottalent.us
    Have I Got Talent?
  616. hawaiipighunter.com
    Hawaii Pig Hunter
  617. heawa.com
    All India Ex-Airmen Association | Home
  618. hellofitness.dk
    Forside | Hello Fitness
  619. hempbank.com
    Hemp Bank
  620. henkude.com
    henkude | Home
  621. hineywinery.com
    Hiney Winery
  622. hiremytech.com
    HireMyTech | Home
  623. hoosierhooves.org
  624. icanomics.com
    ICANomics
  625. iclarks.org
    爱客社区 - iClarks
  626. iheartcity.co.uk
    iheartcity.co.uk | Home
  627. ilblognostro.altervista.org
    Blog per Tutti | Home
  628. iluvclassicmovies.com
    I Luv Classic Movies - Thousands To Choose From
  629. incinerate.eu
    Incinerate – WoW Gilde auf Blackmoore EU
  630. indivibes.net
    Indivibes
  631. irlgames.net
    IRL Games | Jogos Na Vida Real | Home
  632. jaebi.org
    World of The Guardians | Home
  633. jangkeunsukforever.com
  634. jetjoin.com
    jetjoin
  635. jfec.ir
    JundiShapour English Conversation
  636. jibbers.org
    Jibbers.org
  637. jmp.net
    "Never give up !"
  638. juicemissions.org
    J.U.I.C.E | Home
  639. jurandciechanow.pl
    Jurand Ciechanów - Oficjalny Klub Kibica
  640. justbabbleon.com
    Just Babble On
  641. justmeetup.in
    Just Meetup
  642. justqr.co.za
    justqr
  643. kako-smrsaviti.com
    Kako Smršaviti Brzo i Zdravo
  644. kanefitness.com
    KaneFitness.com |Body Beast | P90X | Insanity
  645. khmermovie.net
    Khmer Movie  Just another WordPress site
  646. kiiss.me
    Kiiss
  647. kinklink.me
    Welcome To KinkLink | KinkLink
  648. knappagraphy.com
    KNAPPAGRAPHY
  649. krazysoft.com
    KrazySoft
  650. ktss.net
  651. lanuvola.org
    La Nuvola
  652. lasvegastravelers.com
    Las Vegas Travelers - Your Virtual Tourist
  653. latiendaonline.com.es
    AG-SO
  654. laurierparccanin.com
    Laurier Parc Canin
  655. lawofattraction11.com
    The Law Of Attraction is Real - Are you?
  656. leftyssportsdebates.com
    Lefty's Sports Debates
  657. letmewhine.com
    Let Me Whine
  658. lettermo.com
    A Month of Letters
  659. libertyvoter.org
    LibertyVoter.Org
  660. liftari.org
    Liftari.org | Home
  661. liuhuafang.com
    社会化媒体营销-北漂神游-生命漂流,理想永恒
  662. livon.tv
  663. lmaocr.com
    Lmaocr
  664. loopvid.com
    Welcome | Loopvid
  665. lowcosttravelgroup.com
    lowcosttravelgroup
  666. lowermylegalfees.com
    lowermylegalfees.com
  667. makerlive.net
    Maker Live
  668. mallorca.to
    Mallorca.To
  669. marylandpirates.com
    Maryland Pirates
  670. max-feedback.16mb.com
    max-feedback
  671. maybeheart.com
    maybeheart.com
  672. meantforyou.net
    Meant For You
  673. mebotoo.de
    Mebotoo
  674. mechfactory.com
    Mech Factory - The Ultimate MWO Fansite
  675. megumi-champloo.net
    め組ちゃんぷる
  676. mixdownx.com
    Mixdownx
  677. mommychats.com
    Mommy Chats
  678. movieholics.tv
    Movieholics.TV
  679. mrfuriousrecords.com
    Mr. Furious Records
  680. mtbsedona.com
    mtbsedona.com
  681. mycreativefansite.com
    Creative Labs Zen MP3 Players Sound Blaster Card
  682. mydoops.com
  683. mylove.lv
    My Love
  684. mypetsbook.net
    mypetsbook.net | Home
  685. mysocialreference.com
  686. nagrikshakti.org
    Nagrik Shakti - Just another WordPress site
  687. naturalselfcure.com
    Natural Self Cure home remedies using natural treatments.
  688. nedusunuyorsun.com
    Ne düşünüyorsun? | Home
  689. neislink.com
    NEISlink
  690. netwasall.com
    Netwasall
  691. newsocial.altervista.org
    newsocial | Home
  692. newtheus.com
    NewTheus | Home
  693. nground.com
    NGround
  694. nhlfarmteams.com
    nhlfarmteams.com | Home
  695. noblerubies.com
    Noble Rubies
  696. noentry.asia
    Page not found | Noentry
  697. norwichbodytransformations.com
    Norwich Body Transformations | Home
  698. nvfang.com.cn
    女坊博客
  699. oase-lelystad.nl
    Ping | Home
  700. obeythemassa.org
    Obey The Massa
  701. occupythecorneroffice.com
    OccupytheCornerOffice.com
  702. ofdiet.com
    ofdiet.com
  703. openclassonline.com
    Open Class Online | Open Class Group
  704. opencoursegroup.com
    Open Course Group – Connect with like-minded learners
  705. ourfight.us
    Our Fight | Home
  706. oxigenio.fm
    Oxigénio 102.6 – Música para respirar
  707. p5info.com
    ProcessingJP
  708. paleoprepper.com
    PaleoPrepper
  709. palexpat.com
    palExpat
  710. papiko.ru
    Activity - ПАПиКо Системз
  711. peekybooart.com
    Peeky Boo Art - Share your art creations as royalty free.
  712. peliculasfullhd.com
    | Peliculas Full HD, red social de la alta definición
  713. penziony.net
    Penziony.net
  714. peoplediaries.com
    PEOPLEDIARIES
  715. planetnarcolepsy.com
    Welcome! Planet Narcolepsy
  716. ploosk.com
    PLOOSK
  717. pm-guide.com
    PM-Guide.com | Home
  718. pollittstudio.com
    Home - Harry Pollitt
  719. polynero.com
    Polynero
  720. poordirector.com
    Poor Director
  721. portlandsoxfan.com
    Portland Sox Fan
  722. premioscibersur.com
  723. problemywychowawcze.pl
    ProblemyWychowawcze.pl - Nowy serwis w całości poświęcony problemom wychowawczym. Sprawdźm jak problemy wychowawcze mogą wpłynąć na twoją rodzinę, i jak z nimi walczyć.
  724. projectwrz.com
    Projectwrz
  725. prossimaitalia.it
  726. psihoo.ro
    Psihoo
  727. pssp-uae.com
    PSSP - UAE | Home
  728. qtechgs.com
    Q-Tech Game Studios | Home
  729. rantime.com
    RanTime
  730. reallifesuperheroes.org
    Real Life Superheroes.org
  731. reikimeisterliste.net
    Reiki Meister Liste | Reikimeisterliste | Reiki Master Register
  732. reokelvinexclusive.com
    ReoKelvinExclusive.Com
  733. researchland.net
    ResearchLand
  734. rided5.com
    Ride D5 | Home
  735. rimonhabib.com
    Rimon Habib | | Buddypress Expert | Wordpress Expert
  736. rpandstuffs.com
    RP and Stuffs
  737. rwandinfo.com
    Tout sur le Rwanda - Byose ku Rwanda - Everything on Rwanda
  738. sabuyblog.com
    สร้างบล็อก ทำฟรีบล็อก สมัครเขียนบล็อกฟรี เว็บบล็อกไทย|Free Blog|SabuyBlog.com
  739. schuechtern.eu
    Schüchtern? In zwei Schritten aus der Schüchternheit
  740. scrapedlinks.com
    Free Guest Blogging
  741. scug.be
    SCUG
  742. seizingtheday.net
    Seizing The Day!
  743. shambhalanetwork.org
    Shambhala Network
  744. shoewho.com
    shoeWho? | Home
  745. slashstart.info
    /start.info
  746. socialcanine.com
    Social Canine
  747. solocity.net
    Solocity Network
  748. soportewordpress.info
    Soporte Wordpress
  749. sosyalnet.net
    SosyalNet.Net Sosyal Ağ ve WordPress siteleri oluşturma Sunucusu
  750. soulproprietorsuccesscenter.com
    Soul Proprietor Success Center
  751. southafricansinmelbourne.com
    South Africans in Australia Socially
  752. spatiulcasei.ro
    Site-uri Proiecte Case, Amenajari Interioare, Design Interior, Constructii, Amenajari exterioare SpatiulCasei | Creeaza Site Gratuit
  753. spicybroccolitesting.com.au
    SBM Testing
  754. startbreakdancing.com
    Start Breakdancing
  755. stokedkook.com
    A North Carolina Surfing Community
  756. sven-lehnert.de
  757. swap-art.com
    Swap Art
  758. systemsci.org
    系统科学人
  759. tablejuice.com
    Table juice
  760. tablequiz.net
    tablequiz.net
  761. tagseo.com
    TAGSEO TAG + SEO Chat
  762. talentgraphy.com
    TalentGraphy
  763. talkintalk.com
    talkintalk.com
  764. taskforce141nic.tk
    Clan Spetsnaz
  765. tastenficker.com
    ZyBo sendet wieder | Home
  766. tattoofiend.com
    Tattoo Fiend - Your #1 Tattooing Website Online
  767. teamfailboat.com
    Team Failboat
  768. techplusmore.com
    Tech + More!
  769. teenface.altervista.org
    Teenface | Home
  770. tefltouch.com
    www.tefltouch.com
  771. teikii.info
    クチコミと写真!定期購入まとめサイト – テイキー
  772. texastorque.org
    Texas Torque  Team 1477
  773. thatscalledtalent.com
    That's Called Talent
  774. theartofservice.me
    Watch. Learn anything for free. With numerous courses and videos on every hot topic in IT Management and IT Projects, we're on a mission to help you learn what you want, when you want, at your own pace.
  775. thebarberspace.com
    The BarberSpace
  776. thebleachsociety.com
    TheBleachSociety.com
  777. thecampusnetworks.com
    The Ultimate Campus
  778. thecoolestwebsiteontheinternet.com
    Home | The Coolest Website on the Internet
  779. thedreamerbook.com
    The Dreamer by Phillip Stone | Home
  780. thefoodatlas.com
    thefoodatlas.com | Home
  781. theindigoadults.com
    ANNOUNCEMENT: The Indigo Adults has become more Interactive! | The Indigo Adults: Advice for Indigo
  782. theloonie.ca
    TheLoonie
  783. theministerstoolkit.com
  784. thephysiciansworldnetwork.com
    PhysiciansWorldNetwork.com
  785. thewphowtoblog.com
    WordPress How To | How To Blog | WordPress (WP) How To Blog
  786. theyaresuchhypocrites.com
    My Blog
  787. thoughtgathering.com
  788. thursdayinternet.com
    The Blogs CommunityThe Blogs Community
  789. torquecev.com
    Torque CEVs Official website
  790. toyskidslike.com
    Toys Kids Like - Finding The Best Toys
  791. transformingleaders.net
    Transforming leaders
  792. travelsafety.webatu.com
    Безопасность путешествий
  793. tulsacon.com
    TulsaCon
  794. twing.in
    A Great Funny Articles,Social Networking, Online Chating Website -Twing.in
  795. u2b.me
    Создать учетную запись | Anime News
  796. unfilterblog.com
    Unfilterblog
  797. ungamammor.nu
    atomia-site-title
  798. updates.bz
    UPDATES.bz
  799. urduplus.com
    Urdu Plus
  800. vandymassey.com
    Vandy Massey
  801. velotribes.com
    Velo Tribes: The Cycling Social Network
  802. vincoproduction.com
    Vinco (Video Film) Production
  803. vinocamp.fr
    VinoCamp France
  804. vitavissuta.com
    VitaVissuta.com - Poesia e Narrativa
  805. vivemadridrio.com
    Vive Madrid Río
  806. walkingtimes.altervista.org
    walkingtime | Home
  807. wasanga100porciento.com
    Wasanga 100%
  808. wawooga.com
    Trade Stuff Wawooga.com
  809. webface.com
    Activity | WebFaceWebFace
  810. webfuntime.com
    Web Funtime | Home
  811. wednews.gr
    WEDnews.gr
  812. wewowit.com
    Social Network of Video Lovers: We are mad about videos
  813. whatishid.com
    What Is H.I.D.
  814. wideangletalk.com
    Wide Angle Talk
  815. winroad.info
    WinRoad広場 | ホーム
  816. wordisheard.com
    Word is heard
  817. wordpresspoets.com
    WordpressPoets by NajeebMedia.com
  818. wormrancher.com
    Worm Rancher
  819. wphub.in
    WP Hub
  820. wpmubp.org
    WordPressマルチサイトとBuddyPressガイド |
  821. wpressit.com
    WP Decorator Blogs - Get Your Own Blog and Try out WP Decorator
  822. wschooling.tk
    wSchooling Test - Just another WordPress site
  823. xdreameverything.com
    XDreamEverything | Home
  824. yarn.org.au
    yarn
  825. yeahhackney.com
    yeah! Hackney
  826. youblog.me
    YouBlog.Me
  827. youfarmy.com
    Building Community through Food and Farm
  828. ywamnetworks.com
    YWAM Networks
  829. zimgator.co.zw
    Zimgator

  830. (end of buddypress.org incoming link analysis)

    ↩ Back to buddypress.org - site information


    | dig.do - home | list world top sites | top sites by category | top sites by country | blog | stats | terms of use | contact |