minnalmurali.co.in is dropping on Monday 20 March, 2023 Whois Record of minnalmurali.co.in as on Mon Mar 20 22:08:48 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:08:48Z

sahityagarden.in is dropping on Monday 20 March, 2023 Whois Record of sahityagarden.in as on Mon Mar 20 22:07:46 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:07:46Z

GoSinghTravels.in is dropping on Monday 20 March, 2023 Whois Record of GoSinghTravels.in as on Mon Mar 20 22:06:44 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:06:44Z

ppy10.in is dropping on Monday 20 March, 2023 Whois Record of ppy10.in as on Mon Mar 20 22:05:42 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:05:42Z

aquaawebx.co.in is dropping on Monday 20 March, 2023 Whois Record of aquaawebx.co.in as on Mon Mar 20 22:04:40 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:04:40Z

chetanasharma.in is dropping on Monday 20 March, 2023 Whois Record of chetanasharma.in as on Mon Mar 20 22:03:38 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:03:38Z

ulc789.in is dropping on Monday 20 March, 2023 Whois Record of ulc789.in as on Mon Mar 20 22:02:35 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:02:36Z

haryanaredcrosd.in is dropping on Monday 20 March, 2023 Whois Record of haryanaredcrosd.in as on Mon Mar 20 22:01:33 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:01:34Z

avengersinfinitywarafilmywap.in is dropping on Monday 20 March, 2023 Whois Record of avengersinfinitywarafilmywap.in as on Mon Mar 20 22:00:31 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T22:00:32Z

pvcstarkaari.in is dropping on Monday 20 March, 2023 Whois Record of pvcstarkaari.in as on Mon Mar 20 21:59:29 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:59:30Z

govecancy.in is dropping on Monday 20 March, 2023 Whois Record of govecancy.in as on Mon Mar 20 21:58:27 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:58:28Z

tassido.in is dropping on Monday 20 March, 2023 Whois Record of tassido.in as on Mon Mar 20 21:57:25 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:57:26Z

indianwifenewxnx.in is dropping on Monday 20 March, 2023 Whois Record of indianwifenewxnx.in as on Mon Mar 20 21:56:23 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:56:24Z

DidTore.in is dropping on Monday 20 March, 2023 Whois Record of DidTore.in as on Mon Mar 20 21:55:21 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:55:22Z

iindiatoday.in is dropping on Monday 20 March, 2023 Whois Record of iindiatoday.in as on Mon Mar 20 21:54:19 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:54:20Z

RarerOons.in is dropping on Monday 20 March, 2023 Whois Record of RarerOons.in as on Mon Mar 20 21:53:17 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:53:18Z

findiatoday.in is dropping on Monday 20 March, 2023 Whois Record of findiatoday.in as on Mon Mar 20 21:52:15 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:52:16Z

wwwmaxfashion.in is dropping on Monday 20 March, 2023 Whois Record of wwwmaxfashion.in as on Mon Mar 20 21:51:13 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:51:14Z

iotfirewires.in is dropping on Monday 20 March, 2023 Whois Record of iotfirewires.in as on Mon Mar 20 21:50:11 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:50:12Z

wish-caed.in is dropping on Monday 20 March, 2023 Whois Record of wish-caed.in as on Mon Mar 20 21:49:09 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:49:10Z

ayusenterprises.in is dropping on Monday 20 March, 2023 Whois Record of ayusenterprises.in as on Mon Mar 20 21:48:07 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:48:08Z

mubaidj.in is dropping on Monday 20 March, 2023 Whois Record of mubaidj.in as on Mon Mar 20 21:47:05 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:47:06Z

RisingStar777.in is dropping on Monday 20 March, 2023 Whois Record of RisingStar777.in as on Mon Mar 20 21:46:03 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:46:04Z

srudsddugky.in is dropping on Monday 20 March, 2023 Whois Record of srudsddugky.in as on Mon Mar 20 21:45:01 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:45:01Z

sidhincg.in is dropping on Monday 20 March, 2023 Whois Record of sidhincg.in as on Mon Mar 20 21:43:59 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:43:59Z

HammerKingPlus.in is dropping on Monday 20 March, 2023 Whois Record of HammerKingPlus.in as on Mon Mar 20 21:42:57 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:42:57Z

angraphicsdesign.in is dropping on Monday 20 March, 2023 Whois Record of angraphicsdesign.in as on Mon Mar 20 21:41:55 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:41:55Z

tejsharemarketedu.in is dropping on Monday 20 March, 2023 Whois Record of tejsharemarketedu.in as on Mon Mar 20 21:40:53 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:40:53Z

safebuz.in is dropping on Monday 20 March, 2023 Whois Record of safebuz.in as on Mon Mar 20 21:39:50 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:39:51Z

gpmendholi.in is dropping on Monday 20 March, 2023 Whois Record of gpmendholi.in as on Mon Mar 20 21:38:48 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:38:49Z

pa5z.in is dropping on Monday 20 March, 2023 Whois Record of pa5z.in as on Mon Mar 20 21:37:46 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:37:47Z

LudoOrange.in is dropping on Monday 20 March, 2023 Whois Record of LudoOrange.in as on Mon Mar 20 21:36:45 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:36:45Z

OurMovieNews.in is dropping on Monday 20 March, 2023 Whois Record of OurMovieNews.in as on Mon Mar 20 21:35:43 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:35:43Z

AurangabadWow.in is dropping on Monday 20 March, 2023 Whois Record of AurangabadWow.in as on Mon Mar 20 21:34:41 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:34:41Z

snehabandhu.in is dropping on Monday 20 March, 2023 Whois Record of snehabandhu.in as on Mon Mar 20 21:33:39 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:33:39Z

cmitcollege.org.in is dropping on Monday 20 March, 2023 Whois Record of cmitcollege.org.in as on Mon Mar 20 21:32:36 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:32:37Z

MaddoxSo.in is dropping on Monday 20 March, 2023 Whois Record of MaddoxSo.in as on Mon Mar 20 21:31:34 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:31:35Z

FindMy-Maps-Usa.in is dropping on Monday 20 March, 2023 Whois Record of FindMy-Maps-Usa.in as on Mon Mar 20 21:30:32 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:30:33Z

harmanobd.in is dropping on Monday 20 March, 2023 Whois Record of harmanobd.in as on Mon Mar 20 21:29:30 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:29:31Z

tnsant.in is dropping on Monday 20 March, 2023 Whois Record of tnsant.in as on Mon Mar 20 21:28:28 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:28:29Z

ungdi.in is dropping on Monday 20 March, 2023 Whois Record of ungdi.in as on Mon Mar 20 21:27:26 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:27:27Z

teendarwaza.in is dropping on Monday 20 March, 2023 Whois Record of teendarwaza.in as on Mon Mar 20 21:26:24 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:26:25Z

gadzethub.in is dropping on Monday 20 March, 2023 Whois Record of gadzethub.in as on Mon Mar 20 21:25:22 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:25:23Z

akshaydhokememorialtrust.co.in is dropping on Monday 20 March, 2023 Whois Record of akshaydhokememorialtrust.co.in as on Mon Mar 20 21:24:20 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:24:20Z

icproo.in is dropping on Monday 20 March, 2023 Whois Record of icproo.in as on Mon Mar 20 21:23:18 UTC 2023 Domain Name: icproo.in Registry Domain ID: DC6EE3ABAC27D4CB58A9328C7C2419BAA-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:46:00Z Creation Date: 2022-01-11T06:49:37Z Registry Expiry Date: 2023-01-11T06:49:37Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

mx-app1e-la.in is dropping on Monday 20 March, 2023 Whois Record of mx-app1e-la.in as on Mon Mar 20 21:22:16 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:22:16Z

laikadogtrainers.in is dropping on Monday 20 March, 2023 Whois Record of laikadogtrainers.in as on Mon Mar 20 21:21:14 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:21:14Z

rbiiretail.org.in is dropping on Monday 20 March, 2023 Whois Record of rbiiretail.org.in as on Mon Mar 20 21:20:12 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:20:12Z

TheGradTalk.in is dropping on Monday 20 March, 2023 Whois Record of TheGradTalk.in as on Mon Mar 20 21:19:10 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:19:10Z

MyCommBankingSecured-Log.in is dropping on Monday 20 March, 2023 Whois Record of MyCommBankingSecured-Log.in as on Mon Mar 20 21:18:08 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:18:08Z

BehaviourMatters7.co.in is dropping on Monday 20 March, 2023 Whois Record of BehaviourMatters7.co.in as on Mon Mar 20 21:17:05 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:17:06Z

indianseshop.in is dropping on Monday 20 March, 2023 Whois Record of indianseshop.in as on Mon Mar 20 21:16:03 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:16:04Z

MarketingMagnus.in is dropping on Monday 20 March, 2023 Whois Record of MarketingMagnus.in as on Mon Mar 20 21:15:01 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:15:01Z

covid19trakcer.in is dropping on Monday 20 March, 2023 Whois Record of covid19trakcer.in as on Mon Mar 20 21:13:59 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:13:59Z

YumLamaChung.in is dropping on Monday 20 March, 2023 Whois Record of YumLamaChung.in as on Mon Mar 20 21:12:57 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:12:57Z

govgoa.in is dropping on Monday 20 March, 2023 Whois Record of govgoa.in as on Mon Mar 20 21:11:55 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:11:55Z

covid19trakar.in is dropping on Monday 20 March, 2023 Whois Record of covid19trakar.in as on Mon Mar 20 21:10:53 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:10:53Z

covid19tracket.in is dropping on Monday 20 March, 2023 Whois Record of covid19tracket.in as on Mon Mar 20 21:09:51 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:09:51Z

shyambabadarshan.in is dropping on Monday 20 March, 2023 Whois Record of shyambabadarshan.in as on Mon Mar 20 21:08:49 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:08:49Z

healthcsccloud.in is dropping on Monday 20 March, 2023 Whois Record of healthcsccloud.in as on Mon Mar 20 21:07:47 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:07:47Z

GreenLakeviewResort.in is dropping on Monday 20 March, 2023 Whois Record of GreenLakeviewResort.in as on Mon Mar 20 21:06:45 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:06:45Z

teckssra.in is dropping on Monday 20 March, 2023 Whois Record of teckssra.in as on Mon Mar 20 21:05:43 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:05:43Z

tnsan.in is dropping on Monday 20 March, 2023 Whois Record of tnsan.in as on Mon Mar 20 21:04:40 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:04:41Z

vidyasanskaaredu.in is dropping on Monday 20 March, 2023 Whois Record of vidyasanskaaredu.in as on Mon Mar 20 21:03:38 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:03:39Z

SparkleEarning.in is dropping on Monday 20 March, 2023 Whois Record of SparkleEarning.in as on Mon Mar 20 21:02:37 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:02:37Z

ciidigitalevent.in is dropping on Monday 20 March, 2023 Whois Record of ciidigitalevent.in as on Mon Mar 20 21:01:35 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:01:35Z

wbtetresalt.in is dropping on Monday 20 March, 2023 Whois Record of wbtetresalt.in as on Mon Mar 20 21:00:33 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T21:00:33Z

wbtestresult.in is dropping on Monday 20 March, 2023 Whois Record of wbtestresult.in as on Mon Mar 20 20:59:31 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:59:31Z

aptudetestassam.in is dropping on Monday 20 March, 2023 Whois Record of aptudetestassam.in as on Mon Mar 20 20:58:28 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:58:29Z

covid19traick.in is dropping on Monday 20 March, 2023 Whois Record of covid19traick.in as on Mon Mar 20 20:57:26 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:57:27Z

tetjobgroup.in is dropping on Monday 20 March, 2023 Whois Record of tetjobgroup.in as on Mon Mar 20 20:56:25 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:56:25Z

kkmjobs.in is dropping on Monday 20 March, 2023 Whois Record of kkmjobs.in as on Mon Mar 20 20:55:23 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:55:23Z

cbterams.in is dropping on Monday 20 March, 2023 Whois Record of cbterams.in as on Mon Mar 20 20:54:21 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:54:21Z

wbtetresul.in is dropping on Monday 20 March, 2023 Whois Record of wbtetresul.in as on Mon Mar 20 20:53:18 UTC 2023 Domain Name: wbtetresul.in Registry Domain ID: D7A29FE7599254604A2A3EC3C6EE4EF52-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:00:26Z Creation Date: 2022-01-10T18:07:19Z Registry Expiry Date: 2023-01-10T18:07:19Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

sjsbgpcampuscare.in is dropping on Monday 20 March, 2023 Whois Record of sjsbgpcampuscare.in as on Mon Mar 20 20:52:16 UTC 2023 Domain Name: sjsbgpcampuscare.in Registry Domain ID: DB1625434A03042708181740998AA45FB-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:00:19Z Creation Date: 2022-01-10T18:07:19Z Registry Expiry Date: 2023-01-10T18:07:19Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

wbteresult.in is dropping on Monday 20 March, 2023 Whois Record of wbteresult.in as on Mon Mar 20 20:51:14 UTC 2023 Domain Name: wbteresult.in Registry Domain ID: D1D4FA500D62A46498333216BE79DDED1-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:00:24Z Creation Date: 2022-01-10T18:07:19Z Registry Expiry Date: 2023-01-10T18:07:19Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

tnstand.in is dropping on Monday 20 March, 2023 Whois Record of tnstand.in as on Mon Mar 20 20:50:12 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:50:13Z

KitsInnovation.in is dropping on Monday 20 March, 2023 Whois Record of KitsInnovation.in as on Mon Mar 20 20:49:10 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:49:10Z

tnsans.in is dropping on Monday 20 March, 2023 Whois Record of tnsans.in as on Mon Mar 20 20:48:08 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:48:08Z

RedWebSeries.in is dropping on Monday 20 March, 2023 Whois Record of RedWebSeries.in as on Mon Mar 20 20:47:06 UTC 2023 Domain Name: redwebseries.in Registry Domain ID: DCFB4E8E1E3C84192B8EDB64DAA1E23DF-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:17:31Z Creation Date: 2022-01-11T03:01:04Z Registry Expiry Date: 2023-01-11T03:01:04Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

aptitudeteslassam.in is dropping on Monday 20 March, 2023 Whois Record of aptitudeteslassam.in as on Mon Mar 20 20:46:04 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:46:04Z

ApolloDiagnosticsTics.in is dropping on Monday 20 March, 2023 Whois Record of ApolloDiagnosticsTics.in as on Mon Mar 20 20:45:01 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:45:02Z

cbtecams.in is dropping on Monday 20 March, 2023 Whois Record of cbtecams.in as on Mon Mar 20 20:43:59 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:44:00Z

visiponias.in is dropping on Monday 20 March, 2023 Whois Record of visiponias.in as on Mon Mar 20 20:42:57 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:42:58Z

sjsbgpcampussoft.in is dropping on Monday 20 March, 2023 Whois Record of sjsbgpcampussoft.in as on Mon Mar 20 20:41:55 UTC 2023 No Data Found URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2023-03-20T20:41:56Z

vnautoclg.in is dropping on Monday 20 March, 2023 Whois Record of vnautoclg.in as on Mon Mar 20 20:40:53 UTC 2023 Domain Name: vnautoclg.in Registry Domain ID: DA11A3E8CE146417FA1D3312DD972385F-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:00:22Z Creation Date: 2022-01-10T18:07:19Z Registry Expiry Date: 2023-01-10T18:07:19Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

ShahEraTeacher.in is dropping on Monday 20 March, 2023 Whois Record of ShahEraTeacher.in as on Mon Mar 20 20:39:51 UTC 2023 Domain Name: shaherateacher.in Registry Domain ID: D5B716C7DBEEC4E61A8A262C886516224-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:01:12Z Creation Date: 2022-01-10T18:55:08Z Registry Expiry Date: 2023-01-10T18:55:08Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

marwarcbas.in is dropping on Monday 20 March, 2023 Whois Record of marwarcbas.in as on Mon Mar 20 20:38:49 UTC 2023 Domain Name: marwarcbas.in Registry Domain ID: D60FA21E58DC849E9A6387EF0959E7269-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:42:21Z Creation Date: 2022-01-11T05:11:28Z Registry Expiry Date: 2023-01-11T05:11:28Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

SupremeModlingAgency.in is dropping on Monday 20 March, 2023 Whois Record of SupremeModlingAgency.in as on Mon Mar 20 20:37:46 UTC 2023 Domain Name: suprememodlingagency.in Registry Domain ID: D04CABB848BC440A2B09509FD22BD2433-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:42:27Z Creation Date: 2022-01-11T05:11:28Z Registry Expiry Date: 2023-01-11T05:11:28Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…

thsvkcampuscare.in is dropping on Monday 20 March, 2023 Whois Record of thsvkcampuscare.in as on Mon Mar 20 20:36:44 UTC 2023 Domain Name: thsvkcampuscare.in Registry Domain ID: DE0C7B4AA075D4FD39661D103AD88FB3D-IN Registrar WHOIS Server: Registrar URL: https://www.namesilo.com Updated Date: 2023-02-13T20:04:50Z Creation Date: 2022-01-10T22:58:25Z Registry Expiry Date: 2023-01-10T22:58:25Z Registrar: NameSilo, LLC Registrar IANA ID: 1479 Registrar Abuse Contact Email: Registrar…